PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G032180_P01
Common NameMYBR4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 227aa    MW: 25001.9 Da    PI: 6.7278
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G032180_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-153477247
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        + + +E++++v + k+lG++ W++Ia++m+ gRt++++k++w+++
  GRMZM2G032180_P01 34 EPISRQEEDRIVSLQKLLGNR-WSAIAARMP-GRTDNEIKNYWNSL 77
                       567889***************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-5926IPR009057Homeodomain-like
SuperFamilySSF466891.84E-201384IPR009057Homeodomain-like
PROSITE profilePS500904.3331427IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.8E-222781IPR009057Homeodomain-like
PROSITE profilePS5129421.3992882IPR017930Myb domain
SMARTSM007171.4E-133280IPR001005SANT/Myb domain
CDDcd001674.92E-113578No hitNo description
PfamPF002492.4E-133577IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MDGYDRGAHA GLERSGKSCR LRWMNYLQPD LSREPISRQE EDRIVSLQKL LGNRWSAIAA  60
RMPGRTDNEI KNYWNSLIKK KKKKKLKQSM DTGGGGGDYH QSLPGPEPEP EVHRTAAHEG  120
SSAGMYTTTG TGHIDTSEVR VEHGGTTASH NNDSADHPRP SPLPQLPVFA GQVLLDPDAA  180
VRNGEQTAAP AQASSLSLIP FPKSREMNFV EEYVQFLVSL SDDLLEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-18148140107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17884KKKKKKK
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G032180
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G032180_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278210.0KJ727821.1 Zea mays clone pUT5773 MYB-related transcription factor (MYBR4) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669936.11e-162PREDICTED: transcription factor MYB82-like isoform X1
TrEMBLA0A060D1D41e-170A0A060D1D4_MAIZE; MYB-related transcription factor (Fragment)
STRINGGRMZM2G032180_P011e-169(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Representative plantOGRP1976222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-31myb domain protein 46